PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_06A6F9328.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 193aa    MW: 21953.8 Da    PI: 10.3792
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_06A6F9328.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43e-333188259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                           +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp+vv++tYeg+H h+
  Traes_5AL_06A6F9328.2 31 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSEDPSVVITTYEGQHCHH 88
                           8*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-341589IPR003657WRKY domain
SuperFamilySSF1182901.05E-282289IPR003657WRKY domain
PROSITE profilePS5081129.7122590IPR003657WRKY domain
SMARTSM007749.9E-393089IPR003657WRKY domain
PfamPF031062.6E-263188IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MKPTTAGKKG QKRARQQRFA FVTKSEVDHL EDGYRWRKYG QKAVKNSPFP RSYYRCTNSK  60
CTVKKRVERS SEDPSVVITT YEGQHCHHQT SFQRGXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXXXXXXXX XXXXXXXXXP SLQQLNGGDE LRRSTSYSPM ASATQTPSSL VPPDVSFDMG  180
LLGDIVPPGV RNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2723871074Probable WRKY transcription factor 4
2lex_A8e-2723871074Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654481e-141EU665448.1 Triticum aestivum WRKY24 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690361.12e-58PREDICTED: LOW QUALITY PROTEIN: probable WRKY transcription factor 57
RefseqXP_015631422.13e-58PREDICTED: probable WRKY transcription factor 57
RefseqXP_015631421.13e-58PREDICTED: probable WRKY transcription factor 57
TrEMBLW5EUC51e-101W5EUC5_WHEAT; Uncharacterized protein
STRINGMLOC_59259.25e-91(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-52WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]